Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004515730.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HD-ZIP
Protein Properties Length: 762aa    MW: 83535.7 Da    PI: 5.9461
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004515730.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++k +++t++q++eLe++F+++++p++++r +L+k+lgL+ +qVk+WFqNrR+++k
                     79999************************************************999 PP

           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                     la +a++el+k+ + ++p+W+kss    e +n +e+ ++ ++  +       + +ea +++g+++ +++ lve+lld   +W+e+++    +a t
                     6789********************666655555555555544..155899999**************************.*************** PP

           START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwveh 169
                     l+vissg      galq+m +e q++splvp R + ++R+++q+ +g+wv+vdvS+d  ++  +  +++ +++lpSg+++++++ng +k+twv+h
                     *************************************************************999******************************* PP

           START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       ++++ +h+++r+lv+sgla+ga +wvatlqrqce+
                     ***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.97752112IPR001356Homeobox domain
SMARTSM003896.0E-1954116IPR001356Homeobox domain
CDDcd000862.43E-1955112No hitNo description
PfamPF000462.4E-1955110IPR001356Homeobox domain
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PROSITE profilePS5084845.284260496IPR002913START domain
SuperFamilySSF559617.14E-32263493No hitNo description
CDDcd088756.87E-115266492No hitNo description
SMARTSM002349.3E-41269493IPR002913START domain
PfamPF018522.6E-48270493IPR002913START domain
Gene3DG3DSA:3.30.530.206.1E-4373489IPR023393START-like domain
SuperFamilySSF559613.3E-13512697No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-35AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004515730.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLA0A072TS920.0A0A072TS92_MEDTR; Homeobox leucine zipper protein
STRINGGLYMA10G38280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein